gp120(Con_B)

Product Name: gp120(Con_B)
Source: Viral protein purified from 293 cell culture.
Formulation: Each vial contains 100µg of purified protein (1 mg/ml) in PBS.
Product Type:
Protein: 6xHis tagged HIV-1 gp120(Con_B/2006) protein (a.a.34-518)(SEQ: vtvyygvpvwkeatttlfcasdakaydtevhnvwathacvptdpnpqevvlenvtenfnmwknnmve qmhediislwdqslkpcvkltplcvtlnctdlmnatntnttiiyrwrgeikncsfnittsirdkvqk eyalfykldvvpidndntsyrliscntsvitqacpkvsfepipihycapagfailkcndkkfngtgp ctnvstvqcthgirpvvstqlllngslaeeevvirsenftdnaktiivqlnesveinctrpnnntrk sihigpgrafyttgeiigdirqahcnisrakwnntlkqivkklreqfgnktivfnqssggdpeivmh sfncggeffycnttqlfnstwngtwnntegnitlpcrikqiinmwqevgkamyappirgqircssni tgllltrdggnneteifrpgggdmrdnwr
Note:
Immunogen:
Applications: WB,etc
Specificity: >= 95%
reference:

返回