gp120(Con_C)(HIV-1)

Product Name: gp120(Con_C)(HIV-1)
Source: Viral protein purified from 293 cell culture
Formulation: Each vial contains 100µg of purified protein (1 mg/ml) in PBS containing 0.1% BSA and 25% glycerol.
Product Type:
Protein: 6xHis tagged HIV-1 gp120 (Con_C/2006) protein (a.a.34-518) (SEQ: gnlwvtvyygvpvwkeakttlfcasdakayekevhnvwathacvptdpnpqeivlenvtenfnmwkn dmvdqmhediislwdqslkpcvkltplcvtlnctnatnatntmgeikncsfnittelrdkkqkvyal fyrldivplnennsyrlincntsaitqacpkvsfdpipihycapagyailkcnnktfngtgpcnnvs tvqcthgikpvvstqlllngslaeeeiiirsenltnnaktiivhlnesveivctrpnnntrksirig pgqtfyatgdiigdirqahcnisedkwnktlqkvskklkehfpnktikfepssggdleitthsfncr geffycntsklfnstynstnstitlpcrikqiinmwqevgramyappiagnitcksnitgllltrdg gknntetfrpgggdmrdnwrselykyk
Note:
Immunogen:
Applications: WB standard, antibody ELISA, etc
Specificity: Specificity: >= 95%
reference:

返回